iiiii
Browse by Length | Browse from Dictionary | Domain Statistics | Bulk Check | Domains SEO | Words SEO
Enter some keywords and we will generate and find names based on these keywords. Click on the link of available domains to bookmark them or click on the question mark [?] to find the whois details for registered domains.
*(eg: vietnam travel)
characters
characters
* required fields
1 ... 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 ... 40 (451 - 500 of 2000)
C
cityofsavannahcitymanager.netcivildefensewarningsystem.netclassicmoviegreetingcards.net
closequartercombatacademy.netclosetheconningtowerhatch.netcoastsoccerleaguebusiness.net
coastsoccerleaguemegasite.netcoastsoccerleagueuniverse.netcoealligatormarketingzulp.net
coefficientofacceleration.netcoiledheatexchangercastle.netcoiledheatexchangercenter.net
coiledheatexchangerdomain.netcoiledheatexchangergalaxy.netcoiledheatexchangerglobal.net
coiledheatexchangernation.netcoiledheatexchangeronline.netcoiledheatexchangerplanet.net
coliseumitalianrestaurant.netcollegestudentconsultants.netcolumbiarealestatenetwork.net
comedownonyourmarrowbones.netcomeintoyearsofdiscretion.netcommercialprojectsnetwork.net
commissiononnarcoticdrugs.netcommitteeofcorrespondence.netcommunautedupaysdelorient.net
communitydevelopmentgroup.netcompactdiscreadonlymemory.netcompassionresponsenetwork.net
complementarydistribution.netcompletebaldnessstopguide.netcompramoscasasconefectivo.net
computerfachzeitschriften.netcomputergraphicscompanies.netcomputerpropertyvaluation.net
computersciencemanagement.netcondosinsanfernandovalley.netconejovalleygraphicdesign.net
conejovalleywebsitedesign.netconfessionsofastockbroker.netconfidentialcommunication.net
conformitytofactorreality.netcongratulationsgiftbasket.netconquistadecivilizaciones.net
contactlensdisposablelens.netcontinuityconsultinggroup.netcontractmanagementsystems.net
contractorschooldirectory.netcontractorsonlineregister.net 
1 ... 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 ... 40 (451 - 500 of 2000)
Search i

My Bookmarks

  • [no bookmark]
  • [click on a domain to add]

Random Searches

Make money from domains
Park undeveloped domains and get paid for each click! High payout rates.

Earn cash while you sleep
Domain parking is the simplest way to earn money from your registered domain names. The idle domain is used to display relevant ads, every time a consumer clicks on one of the advertisements, you earn cash.

Webmaster? Earn Cash


For Sale

fqa.comAsk
hearing.comAsk
leading.comAsk
9r.comAsk
microphone.com400,000 $US
files.co.ukAsk
talkradio.comAsk
comprar.comAsk
gu.netAsk
hotel.esAsk

Recently Sold

2f2.com3,700 EUR
hornet.com60,000 $US
smart-spas.com2,999 EUR
crypto.today3,000 EUR
zooy.com2,300 EUR
tandemflug.de1,190 EUR
handymitvertrag.de3,500 EUR
intana.com8,000 $US
hy9.com2,001 EUR
triathlon-me.com4,000 EUR
 
Copyright 2000-2007 123finder.com. All rights reserved. Ad Management Solution provided by AdSpeed.com Bookmark | del.icio.us